Vergleich

Apelin-36, bovine Europäischer Partner

ArtNr RP13713
Hersteller GenScript
Menge 0.1 mg
Kategorie
Typ Peptides
Specific against Cattle (Bovine)
Purity > 95%
Sequence LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF ; {LEU}{VAL}{GLN}{PRO}{ARG}{GLY}{PRO}{ARG}{SER}{GLY}{PRO}{GLY}{PRO}{TRP}{GLN}{GLY}{GLY}{ARG}{ARG}{LYS}{PHE}{ARG}{ARG}{GLN}{ARG}{PRO}{ARG}{LEU}{SER}{HIS}{LYS}{GLY}{PRO}{MET}{PRO}{PHE}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP13713-Apelin-36_Bovine, Apelin, a recently isolated neuropeptide that is expressed in the supraoptic and the paraventricular nuclei, acts on specific receptors located on vasopressinergic neurons. Apelin-36 belongs to the apelin family. Apelin is the natural ligand of the orphan receptor APJ and is abundantly secreted in the colostrum. Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products Apelin-36
Lieferbar
Country of Origin
USA
Storage Conditions
Store at -20C. Keep tightly closed. Store in a cool dry place.
Description
Apelin, a recently isolated neuropeptide that is expressed in the supraoptic and the paraventricular nuclei, acts on specific receptors located on vasopressinergic neurons. Apelin-36 belongs to the apelin family. Apelin is the natural ligand of the orphan receptor APJ and is abundantly secreted in the colostrum. Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives.
Solubility
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.1 mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 01.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen