Vergleich

Parathyroid Hormone (PTH) (1-34), Human Europäischer Partner

ArtNr RP01001
Hersteller GenScript
Menge 0,5 mg
Kategorie
Typ Peptides
Specific against Human (Homo sapiens)
Purity > 95%
Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF ; {SER}{VAL}{SER}{GLU}{ILE}{GLN}{LEU}{MET}{HIS}{ASN}{LEU}{GLY}{LYS}{HIS}{LEU}{ASN}{SER}{MET}{GLU}{ARG}{VAL}{GLU}{TRP}{LEU}{ARG}{LYS}{LYS}{LEU}{GLN}{ASP}{VAL}{HIS}{ASN}{PHE}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP01001-Parathyroid_Hormone_PTH_1-34_Human, Parathyroid Hormone (PTH) (1-34) (Human) is a highly purified peptide chemically synthesized by GenScript. Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone accomplishes its job by stimulating at least three processes: mobilization of calcium from bone, enhancing absorption of calcium from the small intestine, suppression of calcium loss in urine. PTH (1-34) is a peptide fragment (34 amino acids) of the naturally occurring human parathyroid hormone that is an important regulator of calcium and phosphorus metabolism. </td></tr><tr><th>Solubility</th><td colspan="7"> Parathyroid Hormone (PTH) (1-34) (Human) is soluble in water. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide (PTH) in the DRY form at 4C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr>
Similar products Parathyroid
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Category
Peptides & Chemicals
Country of Origin
USA
Shipping Temperature
25°C
Storage Conditions
-20°C
Product Line
Other Peptides
Description
Parathyroid Hormone (PTH) (1-34) (Human) is a highly purified peptide chemically synthesized by GenScript. Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone accomplishes its job by stimulating at least three processes: mobilization of calcium from bone, enhancing absorption of calcium from the small intestine, suppression of calcium loss in urine. PTH (1-34) is a peptide fragment (34 amino acids) of the naturally occurring human parathyroid hormone that is an important regulator of calcium and phosphorus metabolism.
Solubility
Parathyroid Hormone (PTH) (1-34) (Human) is soluble in water.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0,5 mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 27.11.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen