« Zurück
Startseite /
Parathyroid Hormone (PTH) (1-34), Human

Parathyroid Hormone (PTH) (1-34), Human

ArtNr	RP01001
Hersteller	GenScript
Menge	0,5 mg
Kategorie	Oncology Peptides & Proteins Peptides By Organ Thyroid Cancer
Typ	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF ; {SER}{VAL}{SER}{GLU}{ILE}{GLN}{LEU}{MET}{HIS}{ASN}{LEU}{GLY}{LYS}{HIS}{LEU}{ASN}{SER}{MET}{GLU}{ARG}{VAL}{GLU}{TRP}{LEU}{ARG}{LYS}{LYS}{LEU}{GLN}{ASP}{VAL}{HIS}{ASN}{PHE}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP01001-Parathyroid_Hormone_PTH_1-34_Human, Parathyroid Hormone (PTH) (1-34) (Human) is a highly purified peptide chemically synthesized by GenScript. Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone accomplishes its job by stimulating at least three processes: mobilization of calcium from bone, enhancing absorption of calcium from the small intestine, suppression of calcium loss in urine. PTH (1-34) is a peptide fragment (34 amino acids) of the naturally occurring human parathyroid hormone that is an important regulator of calcium and phosphorus metabolism. </td></tr><tr><th>Solubility</th><td colspan="7"> Parathyroid Hormone (PTH) (1-34) (Human) is soluble in water. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide (PTH) in the DRY form at 4C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr>
Similar products	Parathyroid
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Peptides & Chemicals
Country of Origin	USA
Shipping Temperature	25°C
Storage Conditions	-20°C
Product Line	Other Peptides
Description	Parathyroid Hormone (PTH) (1-34) (Human) is a highly purified peptide chemically synthesized by GenScript. Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone accomplishes its job by stimulating at least three processes: mobilization of calcium from bone, enhancing absorption of calcium from the small intestine, suppression of calcium loss in urine. PTH (1-34) is a peptide fragment (34 amino acids) of the naturally occurring human parathyroid hormone that is an important regulator of calcium and phosphorus metabolism.
Solubility	Parathyroid Hormone (PTH) (1-34) (Human) is soluble in water.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01001-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0,5 mg

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern