Stresscopin, human

ArtNr	RP10214-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Neuroscience Neuroinflammation Metabolism Glucose Homeostasis Molecular Targets for Neuroscience Neural Signaling Peptides & Proteins Obesity Peptides
Typ	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 ; {THR}{LYS}{PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}{ILE}{MET}{ASN}{LEU}{LEU}{PHE}{ASN}{ILE}{ALA}{LYS}{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{GLN}{ALA}{ALA}{ALA}{ASN}{ALA}{HIS}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10214-Stresscopin_SCP_peptide, Human Stresscopin (SCP) and Stresscopin Related Peptide (SRP), two selectively natural ligands for CRFR2, enable the suppression of food intake, delay gastric emptying, and decrease heat-induced edema. The genes for SCP and SRP, were expressed in central and diverse peripheral tissues. Because CRFR2 is believed to be important in the regulation of the recovery phase of the stress response, SCP and SRP might be important in protecting the organism from damage incurred by prolonged or excessive exposure to stress. Unlike CRF and urocortin, SCP and SRP have minimal effects on ACTH release and the resultant elevations in glucocorticoids. </td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep the container tightly closed. </td></tr><tr><th>Notes</th><td colspan="7"> Urocortin and SRP are two neuropeptides involved in stress reaction and control of food intake.</td></tr>
Similar products	Stresscopin
Lieferbar
Country of Origin	USA
Storage Conditions	Store the peptide at -20C. Keep the container tightly closed.
Description	Human Stresscopin (SCP) and Stresscopin Related Peptide (SRP), two selectively natural ligands for CRFR2, enable the suppression of food intake, delay gastric emptying, and decrease heat-induced edema. The genes for SCP and SRP, were expressed in central and diverse peripheral tissues. Because CRFR2 is believed to be important in the regulation of the recovery phase of the stress response, SCP and SRP might be important in protecting the organism from damage incurred by prolonged or excessive exposure to stress. Unlike CRF and urocortin, SCP and SRP have minimal effects on ACTH release and the resultant elevations in glucocorticoids.
Solubility	The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
C-Terminal	NH2
Notes	Urocortin and SRP are two neuropeptides involved in stress reaction and control of food intake.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern