Vergleich

Peptide YY (PYY) (3-36), human Europäischer Partner

ArtNr RP10354-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against Human (Homo sapiens)
Purity > 95%
Sequence IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 ; {ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}{ASP}{ALA}{SER}{PRO}{GLU}{GLU}{LEU}{ASN}{ARG}{TYR}{TYR}{ALA}{SER}{LEU}{ARG}{HIS}{TYR}{LEU}{ASN}{LEU}{VAL}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10354-Peptide_YY_PYY_3-36_human, Peptide YY (PYY), a novel 36 amino-acid amidated hormone is a component of the complex neuroendocrine control process. This gut hormone (3-36), when infused into subjects, has been shown to reduce food intake in normal-weight and obese individuals. PYY (3-36) infusion also reduces the plasma levels of the hunger-promoting hormone ghrelin. PYY (3-36) levels have been shown to drop pre-meal and then increase post-prandially. In circulation, PYY (3-36) exists in at least two molecular forms: (1-36) and (3-36). PYY (3-36) selectively binds to Y2 receptors, and it has been found in human intestine and circulating blood. </td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. </td></tr>
Similar products Peptide
Lieferbar
Country of Origin
USA
Storage Conditions
Store the peptide at -20C.
Description
Peptide YY (PYY), a novel 36 amino-acid amidated hormone is a component of the complex neuroendocrine control process. This gut hormone (3-36), when infused into subjects, has been shown to reduce food intake in normal-weight and obese individuals. PYY (3-36) infusion also reduces the plasma levels of the hunger-promoting hormone ghrelin. PYY (3-36) levels have been shown to drop pre-meal and then increase post-prandially. In circulation, PYY (3-36) exists in at least two molecular forms: (1-36) and (3-36). PYY (3-36) selectively binds to Y2 receptors, and it has been found in human intestine and circulating blood.
Solubility
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
C-Terminal
NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen