Vergleich

Pancreatic Polypeptide, human Europäischer Partner

ArtNr RP10398-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against Human (Homo sapiens)
Purity > 95%
Sequence APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 ; {ALA}{PRO}{LEU}{GLU}{PRO}{VAL}{TYR}{PRO}{GLY}{ASP}{ASN}{ALA}{THR}{PRO}{GLU}{GLN}{MET}{ALA}{GLN}{TYR}{ALA}{ALA}{ASP}{LEU}{ARG}{ARG}{TYR}{ILE}{ASN}{MET}{LEU}{THR}{ARG}{PRO}{ARG}{TYR}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10398-Pancreatic_Polypeptide_PP_human, Pancreatic Polypeptide is an agonist at Y4 neuropeptide Y receptros. Pancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours.</td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Keep container tightly closed. Store the peptide at -20C. </td></tr>
Similar products Pancreatic
Lieferbar
Country of Origin
USA
Storage Conditions
Keep container tightly closed. Store the peptide at -20C.
Description
Pancreatic Polypeptide is an agonist at Y4 neuropeptide Y receptros. Pancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours.
Solubility
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
C-Terminal
NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen