« Zurück
Startseite /
Gastrin-Releasing Peptide, human

Gastrin-Releasing Peptide, human

ArtNr	RP10791-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology By Cell Type Carcinoma Peptides & Proteins Peptides By Organ Lung Cancer
Typ	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 ; {VAL}{PRO}{LEU}{PRO}{ALA}{GLY}{GLY}{GLY}{THR}{VAL}{LEU}{THR}{LYS}{MET}{TYR}{PRO}{ARG}{GLY}{ASN}{HIS}{TRP}{ALA}{VAL}{GLY}{HIS}{LEU}{MET}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10791-Gastrin_Releasing_Peptide _GRP_human, Gastrin-releasing peptide (GRP) is released by the post-ganglionic fibres of the vagus nerve, which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumor marker in the diagnosis of small-cell lung carcinoma. </td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep container tightly closed. </td></tr>
Similar products	Gastrin-Releasing
Lieferbar
Country of Origin	USA
Storage Conditions	Store the peptide at -20C. Keep container tightly closed.
Description	Gastrin-releasing peptide (GRP) is released by the post-ganglionic fibres of the vagus nerve, which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumor marker in the diagnosis of small-cell lung carcinoma.
Solubility	The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.