« Zurück
Startseite /
Adrenomedullin (AM) (22-52), human

Adrenomedullin (AM) (22-52), human

ArtNr	RP11293-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides By Organ Lung Cancer Breast Cancer
Typ	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 ; {THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11293_0_5-Adrenomedullin_AM_22_52_human, Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin. ADM is produced in peripheral tissues, adrenal medulla, lung, and kidney. ADM has specific receptors on astrocytes and it is unregulated in ischaemia. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide in the DRY form at, - 20C. For best and repeatable results, rehydrate the peptide immediately before using. The peptide is stable under 4 C for three days once reconstituted. Do not re-freeze any unused portions. </td></tr>
Similar products	Adrenomedullin
Lieferbar
Country of Origin	USA
Storage Conditions	Before using, store the peptide in the DRY form at, - 20C. For best and repeatable results, rehydrate the peptide immediately before using. The peptide is stable under 4 C for three days once reconstituted. Do not re-freeze any unused portions.
Description	Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin. ADM is produced in peripheral tissues, adrenal medulla, lung, and kidney. ADM has specific receptors on astrocytes and it is unregulated in ischaemia.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.