LL37 (Human)

ArtNr	RP13323
Hersteller	GenScript
Menge	0,2 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	[LL-37, 37 aa] ; {LEU}{LEU}{GLY}{ASP}{PHE}{PHE}{ARG}{LYS}{SER}{LYS}{GLU}{LYS}{ILE}{GLY}{LYS}{GLU}{PHE}{LYS}{ARG}{ILE}{VAL}{GLN}{ARG}{ILE}{LYS}{ASP}{PHE}{LEU}{ARG}{ASN}{LEU}{VAL}{PRO}{ARG}{THR}{GLU}{SER}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP13323-LL37_Human_Cathelicidin_anti-microbial_peptide, The cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity. </td></tr><tr><th>Solubility</th><td colspan="7"> Insoluble in water. Dissolve the peptide in 10% acetonitrile with 0.1% TFA solution. Further dilute with desired buffer. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the product at -20C. Keep container tightly closed. Store in a cool dry place. </td></tr>
Similar products	LL37
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Peptides & Chemicals
Country of Origin	USA
Shipping Temperature	25°C
Storage Conditions	-20°C
Product Line	Other Peptides
Description	The cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity.
Solubility	Insoluble in water. Dissolve the peptide in 10% acetonitrile with 0.1% TFA solution. Further dilute with desired buffer.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.