Apelin-36, human

ArtNr	RP13714
Hersteller	GenScript
Menge	0.1 mg
Kategorie	Oncology Neuroscience Metabolism Glucose Homeostasis Molecular Targets for Neuroscience By Cell Type Hematology Lymphoma Peptides & Proteins Obesity Peptides
Typ	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF ; {LEU}{VAL}{GLN}{PRO}{ARG}{GLY}{SER}{ARG}{ASN}{GLY}{PRO}{GLY}{PRO}{TRP}{GLN}{GLY}{GLY}{ARG}{ARG}{LYS}{PHE}{ARG}{ARG}{GLN}{ARG}{PRO}{ARG}{LEU}{SER}{HIS}{LYS}{GLY}{PRO}{MET}{PRO}{PHE}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP13714-Apelin-36_Human, Apelin, a recently isolated neuropeptide expressed in the supraoptic and the paraventricular nuclei, acts on specific receptors located on vasopressinergic neurons. Apelin-36 belongs to the apelin family. Apelin is the natural ligand of the orphan receptor APJ and is abundantly secreted in the colostrum. Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep container tightly closed. Store in a cool dry place. </td></tr>
Similar products	Apelin-36
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C. Keep container tightly closed. Store in a cool dry place.
Description	Apelin, a recently isolated neuropeptide expressed in the supraoptic and the paraventricular nuclei, acts on specific receptors located on vasopressinergic neurons. Apelin-36 belongs to the apelin family. Apelin is the natural ligand of the orphan receptor APJ and is abundantly secreted in the colostrum. Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.1 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern