Urocortin III, mouse

Hersteller GenScript
Kategorie
Typ Peptides
Specific against Mouse
Menge 0.5mg
ArtNr RP10101-0.5
eClass 6.1 34160400
eClass 9.0 32160409
Lieferbar
Sequence (one-letter code)
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
Sequence (three-letter code)
{PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}{ILE}{MET}{ASN}{ILE}{LEU}{PHE}{ASN}{ILE}{ASP}{LYS}{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{LYS}{ALA}{ALA}{ALA}{ASN}{ALA}{GLN}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
C-Terminal
NH2
Description
Mouse UcnIII is expressed predominantly in regions of the brain known to be involved in stress-related behaviours, and its expression in the hypothalamus increases following restraint.
Solubility
Insoluble in water. Dissolve peptide with 100-200 ml of DMSO then dilute up with desired buffer.
Purity
> 95%
Storage
Store at -20C

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 0.5mg
Lieferbar: In stock
Listenpreis: 177,80 €
Preis: 177,80 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen