Urocortin III, mouse

ArtNr	RP10101-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Metabolism Glucose Homeostasis Peptides & Proteins Obesity Peptides
Typ	Peptides
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95%
Sequence	FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 ; {PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}{ILE}{MET}{ASN}{ILE}{LEU}{PHE}{ASN}{ILE}{ASP}{LYS}{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{LYS}{ALA}{ALA}{ALA}{ASN}{ALA}{GLN}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10101-Urocortin_III_UcnIII_mouse, Mouse UcnIII is expressed predominantly in regions of the brain known to be involved in stress-related behaviours, and its expression in the hypothalamus increases following restraint. </td></tr><tr><th>Solubility</th><td colspan="7"> Insoluble in water. Dissolve peptide with 100-200 ml of DMSO then dilute up with desired buffer. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C </td></tr>
Similar products	Urocortin
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C
Description	Mouse UcnIII is expressed predominantly in regions of the brain known to be involved in stress-related behaviours, and its expression in the hypothalamus increases following restraint.
Solubility	Insoluble in water. Dissolve peptide with 100-200 ml of DMSO then dilute up with desired buffer.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern