Urocortin III, mouse

Hersteller GenScript
Kategorie
Typ Peptides
Specific against Mouse
Menge 0.5mg 
ArtNr RP10101-0.5
eClass 6.1 34160400
eClass 9.0 32160409
Lieferbar
Sequence (one-letter code)
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
Sequence (three-letter code)
{PHE}{THR}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{THR}{ASN}{ILE}{MET}{ASN}{ILE}{LEU}{PHE}{ASN}{ILE}{ASP}{LYS}{ALA}{LYS}{ASN}{LEU}{ARG}{ALA}{LYS}{ALA}{ALA}{ALA}{ASN}{ALA}{GLN}{LEU}{MET}{ALA}{GLN}{ILE}-NH2
C-Terminal
NH2
Description
Mouse UcnIII is expressed predominantly in regions of the brain known to be involved in stress-related behaviours, and its expression in the hypothalamus increases following restraint.
Solubility
Insoluble in water. Dissolve peptide with 100-200 ml of DMSO then dilute up with desired buffer.
Purity
> 95%
Storage
Store at -20C
Menge: 0.5mg 
Lieferbar: In stock
Listenpreis: 195,58 €
Preis: 195,58 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen