Vergleich

Exendin (9-39) Europäischer Partner

ArtNr RP10872-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against other
Purity > 95%
Sequence DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 ; {ASP}{LEU}{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}{VAL}{ARG}{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}{GLY}{GLY}{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}{SER}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10872-Exendin _9-39, Exendin (9-39) is an inverse agonist of the murine glucagon-like peptide-1 receptor. There are implications for basal intracellular cyclic adenosine 3', 5'-monophosphate levels and beta-cell glucose competence. Exendin (9-39) is a competitive inhibitor of Exendin-3 and Exendin-4. On digestive smooth muscle, exendin (9-39) behaves as an antagonist for two members of the glucagon-receptor family, GLP-1 and glicentin. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. </td></tr><tr><th>Notes</th><td colspan="7"> Specific exendin receptor antagonist.</td></tr>
Similar products Exendin
Lieferbar
Country of Origin
USA
Storage Conditions
Store the peptide at -20C.
Description
Exendin (9-39) is an inverse agonist of the murine glucagon-like peptide-1 receptor. There are implications for basal intracellular cyclic adenosine 3', 5'-monophosphate levels and beta-cell glucose competence. Exendin (9-39) is a competitive inhibitor of Exendin-3 and Exendin-4. On digestive smooth muscle, exendin (9-39) behaves as an antagonist for two members of the glucagon-receptor family, GLP-1 and glicentin.
Solubility
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
C-Terminal
NH2
Notes
Specific exendin receptor antagonist.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?