Vergleich

Neuropeptide Y(1-36) Europäischer Partner

ArtNr RP20520
Hersteller GenScript
Menge 1 mg
Kategorie
Typ Peptides
Specific against other
Purity > 95%
Sequence YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY ; {Tyr}{Pro}{Ser}{Lys}{Pro}{Asp}{Asn}{Pro}{Gly}{Glu}{Asp}{Ala}{Pro}{Ala}{Glu}{Asp}{Met}{Ala}{Arg}{Tyr}{Tyr}{Ser}{Ala}{Leu}{Arg}{His}{Tyr}{Ile}{Asn}{Leu}{Ile}{Thr}{Arg}{Gln}{Arg}{Tyr}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP20520-Neuropeptide_Y_1-36, Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. </td></tr>
Similar products Neuropeptide
Lieferbar
Country of Origin
USA
Storage Conditions
Store the peptide at -20C.
Description
Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen