Neuropeptide Y(1-36)

Hersteller GenScript
Kategorie
Typ Peptides
Specific against other
Menge 1mg
ArtNr RP20520
Eclass 6.1 34160400
Eclass 9.0 32160409
Lieferbar
Sequence (one-letter code)
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Sequence (three-letter code)
{Tyr}{Pro}{Ser}{Lys}{Pro}{Asp}{Asn}{Pro}{Gly}{Glu}{Asp}{Ala}{Pro}{Ala}{Glu}{Asp}{Met}{Ala}{Arg}{Tyr}{Tyr}{Ser}{Ala}{Leu}{Arg}{His}{Tyr}{Ile}{Asn}{Leu}{Ile}{Thr}{Arg}{Gln}{Arg}{Tyr}
Description
Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.
Purity
> 95%
Storage
Store the peptide at -20C.
Menge: 1mg
Lieferbar: In stock
Listenpreis: 203,58 €
Preis: 203,58 €
lieferbar

Angebot anfordern

Fragen zum Produkt?

Ihr Ansprechpartner:

Arne Pelz

sales@hoelzel.de

Schließen