« Zurück
Startseite /
Amylin (8-37), amide, rat

Amylin (8-37), amide, rat

ArtNr	RP11277-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology Neuroscience Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Endocrine Regulation of Lipid Metabolism Peptides By Organ Breast Cancer
Typ	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 ; {ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{PRO}{VAL}{LEU}{PRO}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11277-Amylin_8-37_Diabetes_Associated_Peptide_DAP_rat, Amylin is a 37-aa peptide produced in the pancreatic beta-cell secretory granules and Amylin is co-released with insulin. Amylin has specific binding sites in the CNS and Amylin may regulate gastric emptying and influence carbohydrate metabolism. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. </td></tr>
Similar products	Amylin
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed.
Description	Amylin is a 37-aa peptide produced in the pancreatic beta-cell secretory granules and Amylin is co-released with insulin. Amylin has specific binding sites in the CNS and Amylin may regulate gastric emptying and influence carbohydrate metabolism.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern