« Zurück
Startseite /
Adrenocorticotropic Hormone (ACTH) (1-39), rat

Adrenocorticotropic Hormone (ACTH) (1-39), rat

ArtNr	RP11305-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Typ	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF ; {SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}{LYS}{PRO}{VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}{LYS}{VAL}{TYR}{PRO}{ASN}{VAL}{ALA}{GLU}{ASN}{GLU}{SER}{ALA}{GLU}{ALA}{PHE}{PRO}{LEU}{GLU}{PHE}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11305-ACTH_1-39_Adrenocorticotropic_hormone_rat, Peptide fragments of ACTH (1-39) were formed during in vitro incubation of the peptide with membrane preparations. ACTH (1-39) were isolated by high pressure liquid chromatography, and peptide fragments of ACTH (1-39) characterized by determination of amino acid composition and NH2- terminal residue. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide in the DRY form at 0-5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr>
Similar products	Adrenocorticotropic
Lieferbar
Country of Origin	USA
Storage Conditions	Before using, store the peptide in the DRY form at 0-5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Description	Peptide fragments of ACTH (1-39) were formed during in vitro incubation of the peptide with membrane preparations. ACTH (1-39) were isolated by high pressure liquid chromatography, and peptide fragments of ACTH (1-39) characterized by determination of amino acid composition and NH2- terminal residue.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.