OTOR, Human

ArtNr	Z02807-20
Hersteller	GenScript
Menge	20 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Bladder Cancer
Typ	Proteins
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against	Human (Homo sapiens)
Purity	>97% by SDS-PAGE and HPLC analyses.
Sequence	MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMG VVGYFPRNLV KEQRVYQEAT KEVPTTDIDF FCE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	protein/Z02807-Otoraplin_OTOR_Human, OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3)-like domain. OTOR is predominantly expressed in the cochlea of the inner-ear and to a lesser extent in fetal brain and in some cartilage tissues. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function.</td></tr><tr><th>M.W.</th><td colspan="7"> 12.7 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuOTOR as determined by LAL method.</td></tr><tr><th>Storage</th><td colspan="7"> This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.</td></tr><tr><th>Formulation</th><td colspan="7"> Lyophilized from a 0.2&
Similar products	Otoraplin
Lieferbar
Country of Origin	USA
Storage Conditions	This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Molecular Weight	12.7 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids.
Product Line	Cytokine, Chemokines & Growth Factors
Description	OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3)-like domain. OTOR is predominantly expressed in the cochlea of the inner-ear and to a lesser extent in fetal brain and in some cartilage tissues. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Formulation	Lyophilized from a 0.2µ, m filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Endotoxin Level	Less than 0.2EU/ug of rHuOTOR as determined by LAL method.
Usage	This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Z02807-20-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern