Vergleich

MCP-2/CCL8, Human Europäischer Partner

ArtNr Z02834-10
Hersteller GenScript
Menge 10 ug
Kategorie
Typ Proteins
Format Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against Human (Homo sapiens)
Purity >96% by SDS-PAGE and HPLC analyses.
Sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02834-MCP-2_CCL8_Human, MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the CC family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1.MCP-3 also shares 58% amino acid identity with MCP-2.Similarly to other CC chemokines, all three MCP proteins are monocyte chemoattractants. In addition,the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils.</td></tr><tr><th>M.W.</th><td colspan="7"> 8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >96% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuMCP-2/CCL8 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50 for this effect is typically 0.03-0.1&
Similar products MCP-2/CCL8
Lieferbar
Specificity Fully biologically active when compared to standard. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50 for this effect is typically 0.03-0.1µ,g/mL.
Country of Origin
USA
Storage Conditions
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Molecular Weight
8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids.
Product Line
Cytokine, Chemokines & Growth Factors
Manufacturer - Specificity
Fully biologically active when compared to standard. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50 for this effect is typically 0.03-0.1µ, g/mL.
Description
MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the CC family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1.MCP-3 also shares 58% amino acid identity with MCP-2.Similarly to other CC chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Formulation
Lyophilized from a 0.2µ, m filtered concentrated, solution in 20mM PB, pH 7.4, 100mM NaCl.
Endotoxin Level
Less than 0.2EU/ug of rHuMCP-2/CCL8 as determined by LAL method.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen