Hersteller |
GENWAY
|
Kategorie |
|
Typ |
Antibody |
Specific against |
other |
Applikationen |
WB |
Menge |
0.05 mg |
ArtNr |
18-003-42415 |
eClass 6.1 |
32160702 |
eClass 9.0 |
32160702 |
Lieferbar |
|
Genway ID: |
GWB-E78860 |
Antigen Specificity: |
Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human CLDN16. |
Immunogen: |
Synthetic peptide sequence derived from: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA |
Appearance: |
Lyophilized powderPeptide based ELISA: 1:62500WB: Antibody |
Dilution: |
0. 5ug/ml |
Handling: |
Add 50ul of distilled water to this antibody before use. |
Note: |
Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16 a member of the claudin family is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys specifically in the thick ascending limb of Henle where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in the corresponding gene are a cause of primary hypomagnesemia which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria resulting in nephrocalcinosis and renal failure. Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene a member of the claudin family is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys specifically in the thick ascending limb of Henle where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria resulting in nephrocalcinosis and renal failure. Publication |
Note: |
This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Function: |
Plays a major role in tight junction-specific obliteration of the intercellular space through calcium-independent cell-adhesion activity. Involved in paracellular magnesium reabsorption. Required for a selective paracellular conductance. May form alone or in partnership with other constituents an intercellular pore permitting paracellular passage of magnesium and calcium ions down their electrochemical gradients. Alternatively it could be a sensor of magnesium concentration that could alter paracellular permeability mediated by other factors. |
Subcellular Location: |
Cell junction tight junction; Multi-pass membrane protein. |
Tissue Specificity: |
Kidney-specific including the thick ascending limb of Henle (TAL). |
Disease: |
Defects in CLDN16 are the cause of hypomagnesemia type 3 (HOMG3) [MIM:248250]; also known as familial hypomagnesemia with hypercalciuria and nephrocalcinosis (FHHNC). HOMG3 is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia hypercalciuria and nephrocalcinosis. Recurrent urinary tract infections and kidney stones are often observed. In spite of hypercalciuria patients do not show hypocalcemia. |
Similarity: |
Belongs to the claudin family. Summary: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene a member of the claudin family is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys specifically in the thick ascending limb of Henle where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria resulting in nephrocalcinosis and renal failure. Muller. D. . et al. . (2003) Am. J. Hum. Genet. 73 (6). 1293-1301. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.