« Zurück
Home /
RIPK1 (receptor (TNFRSF)-interacting serine-threonine kinase 1)

RIPK1 (receptor (TNFRSF)-interacting serine-threonine kinase 1)

Hersteller	GENWAY
Kategorie	Oncology Antibodies Cell Biology Cell Status Apoptosis Western Blot Primary Antibodies By Organ Bladder Cancer
Typ	Antibody
Specific against	other
Applikationen	WB
Menge	0.05 mg
ArtNr	18-003-42877
eClass 6.1	32160702
eClass 9.0	32160702
Lieferbar
Genway ID:	GWB-C700AF
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human RIPK1.
Immunogen:	RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ
Appearance:	Lyophilized powderWB: Antibody
Dilution:	0. 25ug/ml
Handling:	Add 50ul of distilled water to this antibody before use.
ELISA Titre:	1:312500
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. FAK overexpression in human tumors provides a survival signal function by binding to RIP and inhibiting its interaction with the death receptor complex.
Function:	Promotes apoptosis and activation of NF-kappa-B. Required for TNFRSF1A mediated activation of NF-kappa-B.
Catalytic Activity:	ATP + a protein = ADP + a phosphoprotein.
Subunit:	Binds to the death domain of TNFRSF6 and TRADD. Is recruited by TRADD to TNFRSF1A in a TNF-dependent process. Binds RIPK3 UBCE7IP1 isoform 3 (ZIN) EGFR IKBKG TRAF1 TRAF2 and TRAF3. Interacts with BNLF1. Interacts with SQSTM1 upon TNF-alpha stimulation. May interacts with MAVS/IPS1.
Subcellular Location:	Cytoplasm.
Ptm:	Proteolytically cleaved by caspase-8 during TNF-induced apoptosis. Cleavage abolishes NF-kappa-B activation and enhances pro-apototic signaling through the TRADD-FADD interaction.
Ptm:	Autophosphorylated on serine and threonine residues.
Similarity:	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
Similarity:	Contains 1 death domain.
Similarity:	Contains 1 protein kinase domain. Kurenova. E. . et al. . (2004) Mol. Cell. Biol. 24 (10). 4361-4371.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.05 mg

lieferbar

Lieferung vsl. bis 28.06.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern