« Zurück
Startseite /
ETS2 (v-ets erythroblastosis virus E26 oncogene homolog 2 (avian))

ETS2 (v-ets erythroblastosis virus E26 oncogene homolog 2 (avian))

ArtNr	18-003-43401
Hersteller	GENWAY
Menge	0.05 mg
Kategorie	Oncology Antibodies By Cell Type Hematology Leukemia Immunohistochemistry Western Blot Primary Antibodies
Typ	Antibody
Applikationen	WB, IHC
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GWB-7FB9B0
Similar products	18-003-43401
Lieferbar
Genway ID:	GWB-7FB9B0
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human ETS2. Peptide
Sequence:	FESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
Category:	Transcription Factor Antibodies
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. ETS2 contains an ETS DNA-binding domain and belongs to the ETS family. ETS2 is a target of protein kinase C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly assoc
Subcellular Location:	Nucleus.
Similarity:	Belongs to the ETS family.
Similarity:	Contains 1 ETS DNA-binding domain.
Similarity:	Contains 1 PNT (pointed) domain. Summary: ETS transcriptions factors such as ETS2 regulate numerous genes and are involved in stem cell development cell senescence and death and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al. 2007 [PubMed 17986575]). [supplied by OMIM]. Geng. C. D. (2005) J. Biol. Chem. 280 (52). 43264-43271.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.05 mg

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern