« Zurück
Startseite /
SERTAD1 (SERTA domain containing 1)

SERTAD1 (SERTA domain containing 1)

ArtNr	18-003-43874
Hersteller	GENWAY
Menge	0.05 mg
Kategorie	Oncology Antibodies Western Blot Primary Antibodies By Organ Lung Cancer
Typ	Antibody
Applikationen	WB
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GWB-E5ACCA
Similar products	18-003-43874
Lieferbar
Genway ID:	GWB-E5ACCA
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human SERTAD1. Western Blot: Suggested dilution at 0. 125 & #956; g/ml
ELISA Titre:	1:312500
Immunogen:	Synthetic peptide sequence derived from:MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSV
Appearance:	Lyophilized powder
Handling:	Add 50& #956; l of distilled water to this antibody before use
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. SERTA is a transcriptional regulator that interacts with the PHD-bromodomain of co-repressors of Kruppel-associated box (KRAB)-mediated repression. KRIP-1(TIF1beta) and TIF1alpha. as well as the co-activator/adaptor p300/CBP. It is a component of a multiprotein complex containing E2F-1 and DP-1
Function:	Acts at E2F-responsive promoters to integrate signals provided by PHD- and/or bromodomain-containing transcription factors. Stimulates E2F-1/DP-1 transcriptional activity. Renders the activity of cyclin D1/CDK4 resistant to the inhibitory effects of p16(INK4a).
Subunit:	Interacts with the PHD-bromodomain of TIF1 TRIM28/TIF1B and p300/CBP. Binds to DP1. Also interacts with CDK4.
Similarity:	Contains 1 SERTA domain. Li. J. . et al. . (2005) Biochemistry 44 (40). 13246-13256.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.05 mg

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern