Vergleich

Peptide YY PYY Human

Hersteller GENWAY
Kategorie
Typ Peptides
Specific against Human
Menge 1 mg
ArtNr 06-271-83414
eClass 6.1 34160400
eClass 9.0 32160409
Lieferbar
Genway ID:
GWB-2D3118
Sequence (One Letter Code):
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH
Sequence:
{TYR} {PRO} {ILE} {LYS} {PRO} {GLU} {ALA} {PRO} {GLY} {GLU} {ASP} {ALA} {SER} {PRO} {GLU} {GLU} {LEU} {ASN} {ARG} {TYR} {TYR} {ALA} {SER} {LEU} {ARG} {HIS} {TYR} {LEU} {ASN} {LEU} {VAL} {THR} {ARG} {GLN} {ARG} {TYR}-NH2 C Terminal: NH2
Formula:
C194H295N55O57 MW: 4309. 75 Peptide YY (PYY) is mainly found in gastrointestinal tract. It is believed to involve the feeding behavior. Gut hormone that inhibits both secretin and cholecystokinin-stimulated pancreatic secretion. Endogenous nonselective agonist at NPY receptors.
Function:
This gut peptide inhibits exocrine pancreatic secretion has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Subcellular Location:
Secreted protein.
Similarity:
Belongs to the NPY family. [1] Bacha F. and Arslanian S. A. et al. Ghrelin and peptide YY in youth: are there race-related differences?[2] Nygaard R. Nielbo S. Schwartz T. W. and Poulsen F. M. et al. The PP-fold solution structure of human polypeptide YY and human PYY3-36 as determined by NMR[3] Feltrin K. L. Patterson M. Ghatei M. A. Bloom S. R. Meyer J. H. Horowitz M. and Feinle-Bisset C. Effect of fatty acid chain length on suppression of ghrelin and stimulation of PYY GLP-2 and PP secretion in healthy men[4] Nematy M. O\' Flynn J. E. Wandrag L. Brynes A. E. Brett S. J. Patterson M. Ghatei M. A. Bloom S. R. and Frost G. S. Changes in appetite related gut hormones in intensive care unit patients: a pilot cohort study[5] Weickert M. O. Reimann M. Otto B. Hall W. L. Vafeiadou K. Hallund J. Ferrari M. Talbot D. Branca F. Bugel S. et al. Soy isoflavones increase preprandial peptide YY (PYY) but have no effect on ghrelin and body weight in healthy postmenopausal women[6] Kohri K. Nata K. Yonekura H. Nagai A. Konno K. Okamoto H. Cloning and structural determination of human peptide YY cDNA and gene. [7] Herzog H. Submitted (NOV-1993) to the EMBL/GenBank/DDBJ databases. [8] Tatemoto K. Nakano I. Makk G. Angwin P. Mann M. Schilling J. Go V. L. W. Isolation and primary structure of human peptide YY. [9] Eberlein G. A. Eysselein V. E. Schaeffer M. Layer P. Grandt D. Goebell H. Niebel W. Davis M. Lee T. D. Shively J. E. et al. A new molecular form of PYY: structural characterization of human PYY(3-36) and PYY(1-36).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 13.06.2024 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen