Vergleich

RRM1 (ribonucleotide reductase M1 polypeptide)

ArtNr 18-003-44344
Hersteller GENWAY
Menge 0.1 mg
Kategorie
Typ Peptides
Applikationen WB
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias GWB-6EEA86
Similar products 18-003-44344
Lieferbar
Genway ID:
GWB-6EEA86
Antigen Specificity:
Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human RRM1. Peptide
Sequence:
ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL
Note:
Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase. an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. Its gene is located in the imprinted gene domain of 11p15. 5 an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome Wilms tumor rhabdomyosarcoma adrenocrotical carcinoma and lung ovarian and breast cancer. Its gene may play a role in malignancies and disease that involve this region. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. This gene encodes one of two non-identical subunits which constitute ribonucleoside-diphosphate reductase an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15. 5 an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome Wilms tumor rhabdomyosarcoma adrenocrotical carcinoma and lung ovarian and breast cancer. This gene may play a role in malignancies and disease that involve this region. This gene is oriented in a head-to-tail configuration with the stromal interaction molecule 1 gene (STIM1) with the 3' end of STIM1 situated 1. 6 kb from the 5' end of this gene.
Function:
Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
Catalytic Activity:
2\' -deoxyribonucleoside diphosphate + thioredoxin disulfide + H2O = ribonucleoside diphosphate + thioredoxin.
Enzyme Regulation:
Under complex allosteric control mediated by the binding of deoxynucleoside triphosphates and ATP to binding sites on the M1 subunit.
Pathway:
Genetic information processing; DNA replication.
Subunit:
Heterodimer of a large and a small subunit. Interacts with RRM2B.
Subcellular Location:
Cytoplasm.
Disease:
Ribonucleotide reductase is thought to mediate the pathogenesis of the immunodeficiency of adenosine deaminase or purine nucleoside phosphorylase. The deoxynucleotides that accumulate in the lymphoid cells of these patients are thought to feed-back inhibit ribonucleotide reductase preventing DNA replication and cell proliferation.
Miscellaneous:
Two distinct regulatory sites have been defined: the specificity site which controls substrate specificity and the activity site which regulates overall catalytic activity. A substrate-binding catalytic site located on M1 is formed only in the presence of the second subunit M2.
Miscellaneous:
The level of the enzyme activity is closely correlated with the growth rate of a cell and appears to vary with the cell cycle.
Similarity:
Belongs to the ribonucleoside diphosphate reductase large chain family.
Similarity:
Contains 1 ATP-cone domain. Summary: This protein is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15. 5 an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome Wilms tumor rhabdomyosarcoma adrenocrotical carcinoma and lung ovarian and breast cancer. This protein may play a role in malignancies and disease that involve this region. Bryan. B. A. . J. Gen. Virol. 87 (PT 3). 519-529 (2006).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen