« Zurück
Startseite /
Interleukin-1 alpha Human Recombinant ( IL 1 alpha Human )

Interleukin-1 alpha Human Recombinant ( IL 1 alpha Human )

ArtNr	PT_41119_10ug
Hersteller	Novateinbio
Menge	10 ug
Kategorie	Neuroscience Neuroinflammation Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion Cell Culture Cytokines
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Purity	Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Sequence	SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interleukin-1 alpha Human Recombinant ( IL 1 alpha Human )
Similar products	Interleukin-1 alpha Human Recombinant ( IL 1 alpha Human )
Lieferbar
Description	Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton. The IL-1A is purified by proprietary chromatographic techniques.
Storage/Stability	Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Purity	Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Form	The protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 25mM Tris-HCl, pH 8.
Protein Background	IL-1 alpha is produced by activated macrophages, stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1A proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Expression host	Escherichia Coli.
Reagent Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Amino acid sequence	SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.
Biological Activity	The ED50 as determined by the dose-dependant stimulation of murine D10S cells is 9 IU/mg.
Solubility	It is recommended to reconstitute the lyophilized Interleukin 1 alpha in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Manufacturers Category	Immunology

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 31 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern