Vergleich

Kv1.1/KCNA1 Blocking Peptide Europäischer Partner

ArtNr ALO-BLP-PC009-0.12mg
Hersteller Alomone
Menge 120 ug
Kategorie
Typ Peptides
Format Lyophilized
Applikationen WB, IHC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Purity >95% (SDS-PAGE)
Formula Lyophilized Powder.
Sequence GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse KV1.1
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Blocking Peptide
Manufacturer - Category
BLP
Manufacturer - Targets
KCNA1
Country of Origin
Israel
Shipping Temperature
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Storage Conditions
Storage before Reconstitution: Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C - Storage after Reconstitution: -20°C.
Manufacturer - Format
Lyophilized powder
Short description
A Blocking Peptide for Anti-Kv1.1/KCNA1 Antibody
Description
A Blocking Peptide for Anti-Kv1.1/KCNA1 Antibody
Standard quality control of each lot
Western blot analysis.
Peptide confirmation
Confirmed by DNA sequence and SDS-PAGE
Part of Immunogen
GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse KV1.1
PH
7, 4
UNSPSC
41116161
Antigen Preadsorption Control
3 µg fusion protein per 1 µg antibody

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 120 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 08.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen