« Zurück
Startseite /
SARS-CoV-2 Spike receptor binding domain, RBD (395-430)

SARS-CoV-2 Spike receptor binding domain, RBD (395-430)

ArtNr	AS-65614
Hersteller	AnaSpec
Menge	0.1 mg
Kategorie	Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Peptides
Typ	Peptides
Specific against	other
Konjugat/Tag	Biotin
Purity	Peak Area by HPLC ≥95%
Sequence	H-Val-Tyr-Ala-Asp-Ser-Phe-Val-Ile-Arg-Gly-Asp-Glu-Val-Arg-Gln-Ile-Ala-Pro-Gly-Gln-Thr-Gly-Lys-Ile-Ala-Asp-Tyr-Asn-Tyr-Lys-Leu-Pro-Asp-Asp-Phe-Thr-Lys(Biotin-LC)-NH2
Citations	1. Wan Y, Shang J, et al. Receptor recognition by the novel coronavirus from Wuhan: an analysis based on decade-long structural studies of SARS coronavirus. J Virol. 2020 Mar 17;94(7). 2. Chen Y, et al. Structure analysis of the receptor binding of 2019-nCoV. Biochem Biophys Res Commun. 2020 Feb 17.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SARS-CoV-2; Spike protein; receptor binding
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Applications	Receptor binding studies; Screening
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Spike protein
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4530.4
Manufacturer - Research Area	Immunology and Infectious disease; Cell Signaling / Virology
Description	This peptide sequence represents residues 395-430 of the RBD (receptor binding domain) identified from the RefSeq (YP_009724390.1) from the spike protein of SARS-CoV-2. The sequence is labeled with Biotin-LC at the C-terminus.
Sequence One-Letter Code	VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT-K(Biotin-LC)-NH2
Post Synthesis Coupling	No
Usage	Research use
GTIN	5400535177539

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-65614-safety-datasheet.pdf