« Zurück
Startseite /
Recombinant human Regenerating islet-derived protein 3-alpha

Recombinant human Regenerating islet-derived protein 3-alpha

ArtNr	OPCA00200-100UG
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Metabolism Diabetes By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Adenocarcinoma Mesothelioma Autophagy Cardiovascular Research Proliferation Myocardial Infarction By Organ Testicular & Prostate Cancer
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Citations	Molecular basis for peptidoglycan recognition by a bactericidal lectin.Lehotzky R.E., Partch C.L., Mukherjee S., Cash H.L., Goldman W.E., Gardner K.H., Hooper L.V.Proc. Natl. Acad. Sci. U.S.A. 107:7722-7727(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	hepatocarcinoma-intestine-pancreas;hepatointestinal pancreatic protein;HIP;HIP/PAP;human proislet peptide;INGAP;pancreatic beta cell growth factor;pancreatitis-associated protein 1;PAP;PAP homologous protein;PAP1;PAP-H;PBCGF;proliferation-inducing protein 34;proliferation-inducing protein 42;reg III-alpha;REG3;REG-3-alpha;regenerating islet-derived 3 alpha;regenerating islet-derived protein 3-alpha;regenerating islet-derived protein III-alpha;REG-III.
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Molecular Weight	43.6 kDa
Gene symbol	REG3A
Gene Fullname	regenerating family member 3 alpha
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Protein name	Regenerating islet-derived protein 3-alpha
Purification	Affinity purified using AC

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPCA00200-100UG-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern