Vergleich

FKBP1A Recombinant Protein (Human)

ArtNr OPCA00443-1MG
Hersteller AVIVA Systems Biology
Menge 1 mg
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Konjugat/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE
Citations Complementary DNA encoding the human T-cell FK506-binding protein, a peptidylprolyl cis-trans isomerase distinct from cyclophilin.Maki N., Sekiguchi F., Nishimaki J., Miwa K., Hayano T., Takahashi N., Suzuki M.Proc. Natl. Acad. Sci. U.S.A. 87:5440-5443(1990)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 12 kDa FK506-binding protein;12 kDa FKBP;calstabin-1;FK506 binding protein 1A,12kDa;FK506 binding protein12;FK506-binding protein 1;FK506-binding protein 12;FK506-binding protein 1A;FK506-binding protein,T-cell,12-kD;FKBP1;FKBP12;FKBP-12;FKBP12-Exip3;FKBP-1A;immunophilin FKBP12;peptidyl-prolyl cis-trans isomerase FKBP1A;PKC12;PKCI2;PPIASE;PPIase FKBP1A;protein kinase C inhibitor 2;rotamase.
Lieferbar
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Molecular Weight
38.2 kDa
Gene symbol
FKBP1A
Gene Fullname
FKBP prolyl isomerase 1A
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Protein name
Peptidyl-prolyl cis-trans isomerase FKBP1A
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen