« Zurück
Startseite /
RPSB Recombinant Protein (Escherichia coli)

RPSB Recombinant Protein (Escherichia coli)

ArtNr	OPCA00764-100UG
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid
Specific against	Escherichia coli (E.coli)
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESFVEAE
Citations	Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	30S ribosomal subunit protein S2;b0169;ECK0168;Small ribosomal subunit protein uS2.
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Molecular Weight	53.6 kDa
Gene symbol	rpsB
Gene Fullname	30S ribosomal subunit protein S2
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Required for ribosomal protein S1 to bind to the 30S subunit.
Protein name	30S ribosomal protein S2
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPCA00764-100UG-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern