« Zurück
Startseite /
Recombinant rat Vesicle-fusing ATPase

Recombinant rat Vesicle-fusing ATPase

ArtNr	OPCA01072-100UG
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Neural Signaling By Cell Type Carcinoma Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins Cardiovascular Research Atherosclerosis
Typ	Proteins Recombinant
Format	Liquid
Specific against	Rat (Rattus norvegicus)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	QAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSII
Citations	Plk2 attachment to NSF induces homeostatic removal of GluA2 during chronic overexcitation.Evers D.M., Matta J.A., Hoe H.S., Zarkowsky D., Lee S.H., Isaac J.T., Pak D.T.Nat. Neurosci. 13:1199-1207(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	NEM-sensitive fusion protein;N-ethylmaleimide-sensitive factor;N-ethylmaleimide-sensitive fusion protein;vesicle-fusing ATPase;vesicular-fusion protein NSF.
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	26.5 kDa
Gene symbol	Nsf
Gene Fullname	N-ethylmaleimide sensitive factor, vesicle fusing ATPase
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 membrane cycling.
Protein name	Vesicle-fusing ATPase
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPCA01072-100UG-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern