Vergleich

Recombinant human Type-1 angiotensin II receptor

ArtNr OPCA01197-100UG
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Citations Cloning, expression, and characterization of a gene encoding the human angiotensin II type 1A receptor.Mauzy C.A., Hwang O., Egloff A.M., Wu L.H., Chung F.-Z.Biochem. Biophys. Res. Commun. 186:277-284(1992)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias AG2S;AGTR1B;Angiotensin II type-1 receptor;AT1;AT1AR;AT1B;AT1BR;AT1R;AT2R1;HAT1R;type-1 angiotensin II receptor;type-1B angiotensin II receptor.
Lieferbar
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Molecular Weight
9.2 kDa
Gene symbol
AGTR1
Gene Fullname
angiotensin II receptor type 1
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Protein name
Type-1 angiotensin II receptor
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen