« Zurück
Startseite /
Recombinant human Carcinoembryonic antigen-related cell adhesion molecule 4

Recombinant human Carcinoembryonic antigen-related cell adhesion molecule 4

ArtNr	OPCA01222-100UG
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neural Adhesion Molecules By Cell Type Carcinoma Hematology Leukemia Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer Colorectal Cancer Breast Cancer Testicular & Prostate Cancer Gallbladder Cancer Gastric Cancer Pancreatic Cancer Thyroid Cancer
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Citations	Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Misumi Y., Nakazato H., Matsuoka Y.J. Biol. Chem. 266:11810-11817(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	carcinoembryonic antigen CGM7;carcinoembryonic antigen gene family member 7;carcinoembryonic antigen related cell adhesion molecule 4;carcinoembryonic antigen-related cell adhesion molecule 4;carcinoembryonic antigen-related cell adhesion molecule 4-sv1;carcinoembryonic antigen-related cell adhesion molecule 4-sv2;CGM7;CGM7_HUMAN;NCA;Nonspecific cross-reacting antigen (NCA);nonspecific cross-reacting antigen W236;non-specific cross-reacting antigen W236.
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	14.7 kDa
Gene symbol	CEACAM4
Gene Fullname	CEA cell adhesion molecule 4
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Protein name	Carcinoembryonic antigen-related cell adhesion molecule 4
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPCA01222-100UG-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 26.02.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern