ArtNr |
RP00050-50ug |
Hersteller |
Abclonal
|
Menge |
50 ug |
Quantity options |
100 ug
10 ug
20 ug
50 ug
5 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
Purity |
> 97% by SDS-PAGE. |
Sequence |
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
NCBI |
IL-11 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
IL11,AGIF,IL-11 |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Manufacturer - Applications |
< 1.0 EU/μg of the protein by LAL method. |
Manufacturer - Category |
Proteins |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Protein Weight |
19.14 kDa |
Manufacturer - Additional Information |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Description |
Recombinant Human IL-11 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro22-Leu199) of human IL-11 (Accession #NP_000632.1) fused with an initial Met at the N-terminus. |
Background |
The protein is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. |
Manufacturer - Cross Reactivity |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Immunogen |
Pro22-Leu199 |
Route |
No tag |
Endotoxin |
< 1.0 EU/μg of the protein by LAL method. |
Manufacturer - Research Area |
Interleukin, Cell Culture related |
Antigen Seq |
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Bioactivity |
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1. 3-5 ng/mL, corresponding to a specific activity of 2×105-7. 69×105units/mg. |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation. |
Expected Protein Size |
19.14 kDa |
Gene Symbol |
IL-11 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.