Vergleich

Recombinant Mouse CXCL12/SDF-1 Protein Europäischer Partner

ArtNr RP00548-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
NCBI CXCL12/SDF-1
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Cxcl12,Stromal cell-derived factor 1,SDF-1,12-O-tetradecanoylphorbol 13-acetate repressedprotein 1,TPAR1,C-X-C motif chemokine 12,Pre-B cell growth-stimulating factor,PBSF,Thymiclymphoma cell-stimulating factor,TLSF,Sdf1
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Cytokines & Cytokine Receptors
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Availability
Inquiry before order
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Mouse CXCL12/SDF-1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys22-Lys89) of mouse CXCL12/SDF-1 alpha (Accession #P40224) fused with an initial Met at the N-terminus.
Background
Mouse Cxcl12 is a secreted and highly conserved protein which belongs to the intercrine alpha (chemokine CxC)family.CXCL12 is widely expressed in various organs including brain, kidney, skeletal muscle, heart, liver, and lymphoidorgans. Cxcl12 activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level ofintracellular calcium ions and chemotaxis. It also binds to atypical chemokine receptor ACKR3 which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Cxcl12 has several critical functions during embryonicdevelopment such as B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Cxcl12plays an important role in acting as a positive regulator of monocyte migration and a negative regulator of monocyteadhesion via the LYN kinase. It stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 andACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. It also plays aprotective role after myocardial infarction, induces down-regulation and internalization of ACKR3 expressed in various cellsand stimulates the proliferation of bone marrow-derived b progenitor cells in the presence of IL-7 as well as growth of thestromal cell-dependent B-cell clone DW34 cells.
Immunogen
Lys22-Lys89
Route
No tag
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Bioactivity
Measured by its ability to chemoattract 5-10 day cultured human peripheral blood lymphocytes (PBL). The ED50 for this effect is 10-30 ng/mL. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CXCR4. The ED50 for this effect is 0. 3-1. 5 ng/mL.
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen