Recombinant Mouse CSF-3/G-CSF Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

Granulocyte colony-stimulating factor (G-CSF) is a growth factor and an essential cytokine which belongs to theIL-6 superfamily. Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesisby controlling the production, differentiation, and function of 2 related white cell populations of the blood, thegranulocytes and the monocytes-macrophages. G-CSF binding to its receptor G-CSF-R which belongs to thecytokine receptor type I family depends on the interaction of alpha-helical motifs of the former and twofibronectin type III as well as an immunoglobulin-like domain of the latter. G-CSF is a cytokine that have beendemonstrated to improve cardiac function and perfusion in myocardial infarction. And it was initially evaluatedas a stem cell mobilizer and erythropoietin as a cytoprotective agent.

Met1-Ala208

< 1 EU/μg of the protein by LAL method.

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

G-CSF/CSF3