ArtNr |
RP01350LQ-10ug |
Hersteller |
Abclonal
|
Menge |
10 ug |
Quantity options |
100 ug
10 ug
20 ug
50 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Mouse (Murine, Mus musculus) |
Purity |
> 90% by SDS-PAGE. |
Dry ice |
Yes
|
Sequence |
TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH |
NCBI |
Dkk-1 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
DKK1,SK,Dickkopf-1,DKK1,DKK1,SK,DKK1 |
Versandbedingung |
Trockeneis |
Lieferbar |
|
Manufacturer - Applications |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Category |
Proteins |
Shipping Temperature |
dry ice |
Storage Conditions |
Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles. |
Protein Weight |
26.99 kDa |
Description |
Recombinant Mouse Dkk-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr32-His272) of mouse DKK-1 (Accession #NP_034181.2) fused with a 6×His tag at the C-terminus. |
Background |
Members of the dickkopf-related protein family (DKK-1, -2, -3, and -4) are secreted proteins with two cysteine-rich domains separated by a linker region. And DKK1 takes part in embryonic development through its inhibition of the WNT signaling pathway, binds to LRP6 with high affinity and prevents the Frizzled-Wnt-LRP6 complex formation in response to Wnts. DKK1 promotes LRP6 internalization and degradation when it forms a ternary complex with the cell surface receptor Kremen.DKK1 not olny functions as a head inducer during development, but also regulates joint remodeling and bone formation, which suggests roles for DKK1 in the pathogenesis of rheumatoid arthritis and multiple myeloma. More recently research reported, DKK1 impacts eye development from a defined developmental time point on, and is critical for lens separation from the surface ectoderm via β-catenin mediated Pdgfrα and E-cadherin expression. |
Immunogen |
Thr32-His272 |
Route |
C-His |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Research Area |
Other Recombinant Protein |
Antigen Seq |
TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH |
Bioactivity |
Measured by its binding ability in a functional ELISA.Immobilized Mouse DKK-1 at 5 μg/mL (100 μL/well) can bind Human LRP-5 with a linear range of 0. 001-0. 623 μg/mL. |
Protein Formulation |
Supplied as a 0.22 μm filtered solution in 20mM Tris, 500mM NaCl, 10% glycerol, pH8.0. |
Expected Protein Size |
26.99 kDa |
Gene Symbol |
Dkk-1 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.