Vergleich

Recombinant Human IgG1 Protein Europäischer Partner

ArtNr RP01354-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Purity > 95% by SDS-PAGE.
NCBI IGHG1
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IgG1 Fc,Ighg1
Lieferbar
Manufacturer - Category
Proteins
Storage Conditions
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Description
Recombinant Human IgG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro100-Lys330) of human IgG1 Fc fused with a 6xHis tag at the C-terminus.
Background
As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (5 kDa ) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcγR ) on phagocytic cells with high affinity. Fc fragment is demonstrated to mediate phagocytosis, trigger inflammation, and target Ig to particular tissues. Protein G or Protein A on the surface of certain Staphylococcal and Streptococcal strains specifically binds with the Fc region of IgGs, and has numerous applications in biotechnology as a reagent for affinity purification. Recombinant IgG Fc Region is suggested to represent a potential anti-inflammatory drug for treatment of human autoimmune diseases.
Manufacturer - Cross Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen
Pro100-Lys330
Recommended Dilution
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Route
C-His
Antigen Seq
PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human Fc-gamma RII-a(CD32a) at 1 μg/mL (100 μL/well) can bind IgG1 Fc with a linear range of 0. 156-3. 47 μg/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen