ArtNr |
RP01372-20ug |
Hersteller |
Abclonal
|
Menge |
20 ug |
Quantity options |
100 ug
10 ug
20 ug
50 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
Purity |
> 95% by SDS-PAGE. |
Sequence |
QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGL |
NCBI |
LILRB2/ILT-4/CD85d |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
LILRB2,CD85D,ILT-4,ILT4,LIR-2,LIR2,MIR-10,MIR10 |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Manufacturer - Applications |
<1EU/μg |
Manufacturer - Category |
Proteins |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Protein Weight |
74.51 kDa |
Manufacturer - Additional Information |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Description |
Recombinant Human LILRB2/ILT-4/CD85d Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Val461) of human LILRB2/CD85d/ILT4 (Accession #AAH36827.1) fused with a Fc, 6×His tag at the C-terminus. |
Background |
Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2) is also known as CD85 antigen-like family member D (CD85d), Immunoglobulin-like transcript 4 (ILT-4), Monocyte / macrophage immunoglobulin-like receptor 10 (MIR-10), which is a member of the the subfamily B class of LIR receptors.Multiple transcript variants encoding different isoforms have been found for the ILT4 gene. ILT4 is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. |
Manufacturer - Cross Reactivity |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Immunogen |
Gln22-Val461 |
Route |
C-hFc&His |
Endotoxin |
<1EU/μg |
Manufacturer - Research Area |
Immune Checkpoint, Bio-Markers & CD Antigens |
Antigen Seq |
QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGV |
Bioactivity |
Measured by its binding ability in a functional ELISA. Immobilized Human LILRB2 Protein at 1μg/mL (100 μL/well) can bind LILRB2 Rabbit pAb with a linear range of 0. 03-6. 78 ng/mL. |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Expected Protein Size |
74.51 kDa |
Gene Symbol |
LILRB2/ILT-4/CD85d |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.