Hersteller |
ProSpec
|
Kategorie |
|
Typ |
Cytokines and Growth Factors |
Specific against |
Human |
Menge |
5ug |
ArtNr |
cyt-310-5ug |
eClass 6.1 |
32161000 |
eClass 9.0 |
42030690 |
Lieferbar |
|
Synonyms |
Melanoma-derived growth regulatory protein precursor, Cartilage-derived retinoic acid-sensitive protein, CD-RAP, MIA |
Introduction |
The Melanoma Inhibitory protein (MIA) was identified as an inhibitor of in vitro growth of malignant melanoma cells. The protein contains a SH3 domain. MIA acts as a potent tumor cell growth inhibitor for malignant melanoma cells and some other neuroectodermal tumors, including gliomas, in an autocrine fashion. In a study of human melanoma cell lines with different metastatic capacity MIA mRNA expression appeared to be inversely correlated with pigmentation. MIA has been shown to represent a very sensitive and specific serum marker for systemic malignant melanoma that might be useful for staging of primary melanomas, detection of progression from localized to metastatic disease during follow-up, and monitoring therapy of advanced melanomas. |
Description |
Melanoma Inhibitory Activity Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12237 Dalton. The MIA is purified by proprietary chromatographic techniques. |
Source |
Escherichia Coli. |
Physical Appearance |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation |
The protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM Potassium-phosphate pH=7 and 150mM potassium chloride. |
Purity |
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Usage |
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
Amino acid sequence |
Agrees with the sequence of native MIA human with an addition N-terminal Methionine residue. MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVV YVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKT DKWDFYCQ. |
Biological Activity |
The biological activity is calculated by the inhibiting effect on the invasion of Mel In Tumor cells and found active in Mel In assay. |
Storage |
Lyophilized MIA although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution MIA should be stored at 4C between 2-7 days and for future use below -18C. Please prevent freeze-thaw cycles. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.