« Zurück
Startseite /
Recombinant Human Macrophage Migration Inhibitor Factor (Active)

Recombinant Human Macrophage Migration Inhibitor Factor (Active)

ArtNr	cyt-596-1mg
Hersteller	ProSpec
Menge	1mg
Kategorie	Neuroscience Neuroinflammation Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Cytokines and Growth Factors
Specific against	Human (Homo sapiens)
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Similar products	MIF (Active)
Lieferbar
Synonyms	Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF
Introduction	The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.
Description	MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Purity	Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM AFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVY INYYDMNAANVGWNNSTFA.
Biological Activity	Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.
Storage	Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution MIF-protein should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

cyt-596-1mg-safety-datasheet.pdf