Vergleich

SARS-CoV-2 (COVID-19) Nucleocapsid (N) Recombinant Protein

ArtNr PRS-10-080-0.1mg
Hersteller ProSci
Menge 0.1 mg
Kategorie
Typ Proteins Recombinant
Format Liquid
Applikationen WB, ELISA
Specific against other
Purity >95% by SDS Page
Dry ice Yes
Sequence MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALT<br />QHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTG<br />PEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGS<br />RGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMS<b
Citations Zhou, P., Yang, X., Wang, X. et al. Nature 579, 270–273. 2020.
Wu, F., Zhao, S., Yu, B. et al. Nature 579, 265–269. 2020.
Wrapp D, Wang N, Corbett KS, et al. bioRxiv. 2020.
Walls AC, Park YJ, Tortorici MA, et al. Cell. 181(2):281-292.e6. 2020.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Versandbedingung Trockeneis
Lieferbar
Manufacturer - Type
Recombinant Proteins
Shipping Temperature
Dry Ice
Storage Conditions
We recommended to store this recombinant protein as received at 2-8˚ C for up to one month. For longer-term storage, aseptically aliquot in working volumes without diluting and store at -80˚ C. Avoid Repeated Freeze Thaw Cycles.
Molecular Weight
The predicted molecular weight of Recombinant SARS-CoV-2, Nucleocapsid (N) Protein is Mr 47 kDa.
Background
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the causative agent of coronavirus disease 2019 (COVID-19), is an enveloped, single-stranded, positive-sense RNA virus that belongs to the Coronaviridae family 1. The SARS-CoV-2 genome, which shares 79.6% identity with SARS-CoV, encodes four essential structural proteins: the spike (S), envelope (E), membrane (M), and nucleocapsid protein (N) 2. The S protein is a transmembrane, homotrimeric, class I fusion glycoprotein that mediates viral attachment, fusion, and entry into host cells 3. Each ~180 kDa monomer contains two functional subunits, S1 (~700 a.a) and S2 (~600 a.a), that mediate viral attachment and membrane fusion, respectively. S1 contains two major domains, the N-terminal (NTD) and C-terminal domains (CTD). In both SARS-CoV and SARS-CoV-2, the CTD contains the receptor-binding domain (RBD), which binds to the angiotensin-converting enzyme 2 (ACE2) receptor on host cells 3-5. The NTD of SARS-CoV-2 does not bind to ACE2 6, and the function of NTD in SARS-CoV-2 infection is not well understood. In other CoVs, the NTD may promote attachment by binding to sugar moieties 7 and might play a role in the conformational change of S2 required for membrane fusion 8. While most neutralizing antibodies target the RBD domain and block receptor binding, potent neutralizing antibodies targeting NTD were isolated from convalescent COVID19 patients 9, identifying the NTD as an attractive candidate for vaccines and therapeutics. In addition, the NTD is a promising antigen for diagnostic tests, as there is only 53.5% homology between the NTD of SARS-CoV-2 and SARS-CoV 10.
By Type
Infectious Disease, COVID-19
Concentration
0.5 mg/ml
Buffer
This recombinant protein was 0.2 µm filtered and lyophilized from modified Dulbecco’s phosphate buffered saline (1X PBS) pH 7.2 – 7.3 with no calcium, magnesium, or preservatives.

Application Note
ELISA, WB
NCBI Official Name
nucleocapsid protein
NCBI Organism
Severe acute respiratory syndrome coronavirus 2
Disclaimer
Optimal dilutions/concentrations should be determined by the end user. The information provided is a guideline for product use. This product is for research use only.
Manufacturer - Species
SARS-CoV-2
By Species
Other

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen