Vergleich

15-PGDH Recombinant Protein

ArtNr PRS-91-661-0.05mg
Hersteller ProSci
Menge 0.05 mg
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against other
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Dry ice Yes
Sequence MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQD
NCBI HPGD
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 15-Hydroxyprostaglandin Dehydrogenase [NAD(+)], 15-PGDH, Prostaglandin Dehydrogenase 1, HPGD, PGDH1
Lieferbar
Manufacturer - Applications
This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag
C-6 His tag
Storage Conditions
Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Molecular Weight
30 kD
Background
15-hydroxyprostaglandin dehydrogenase [NAD(+)], also known as Prostaglandin dehydrogenase 1, 15-PGDH, HPGD and PGDH1, belongs to the short-chain dehydrogenases/reductases (SDR) family. HPGD localizes to the cytoplasm and can be found in colon epithelium, existing as a homodimer. HPGD catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. HPGD is down-regulated by cortisol, dexamethasone and betamethasone, up-regulated by TGFB1. HPGD inhibits in vivo proliferation of colon cancer cells. HPGD is the key enzyme for the inactivation of prostaglandins, and thus regulates processes such as inflammation or proliferation.
Protein Gi #
372626423
Buffer
Supplied as a 0.2 um filtered solution of 20mM HEPES, 150mM NaCl, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
NCBI Official Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
NCBI Organism
Homo sapiens
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.05 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen