Vergleich

Carbonic Anhydrase 3 Recombinant Protein

ArtNr PRS-92-083-0.05mg
Hersteller ProSci
Menge 0.05 mg
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against other
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Dry ice Yes
Sequence AKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVR
NCBI CA3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Carbonic Anhydrase 3, Carbonate Dehydratase III, Carbonic Anhydrase III, CA-III, CA3
Lieferbar
Manufacturer - Applications
This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag
C-6 His tag
Storage Conditions
Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Molecular Weight
30.6 kD
Background
Carbonic Anhydrase 3 (CA3) belongs to the Alpha-Carbonic Anhydrase family that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and it is present at high levels in skeletal muscle with much lower levels found in cardiac and smooth muscle. CA3 is activated by proton donors such as imidazole and the dipeptide histidylhistidine. CA3 is inhibited by coumarins and sulfonamide derivatives such as acetazolamide.
Protein Gi #
767983919
Buffer
Supplied as a 0.2 um filtered solution of 20mM Tris, 150mM NaCl, pH 7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
NCBI Official Name
carbonic anhydrase 3
NCBI Organism
Homo sapiens
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.05 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen