Vergleich

NCR3 Recombinant Protein

ArtNr PRS-92-151-0.05mg
Hersteller ProSci
Menge 0.05 mg
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against other
Konjugat/Tag Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Sequence LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG
NCBI NCR3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Natural Cytotoxicity Triggering Receptor 3, Activating Natural Killer Receptor p30, Natural Killer Cell p30-Related Protein, NK-p30, NKp30, CD337, NCR3, 1C7, LY117
Lieferbar
Manufacturer - Applications
This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag
C-Fc tag
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Molecular Weight
40.2 kD
Background
Natural Cytotoxicity Triggering Receptor 3 (NCR3) along with NKp44 and NKp46 constitute a group of receptors termed “Natural Cytotoxicity Receptors”. They play a major role in triggering NK-mediated killing of most tumor cells lines. NKp30 is a type I transmembrane protein having a single extracellular V-like immunoglobulin domain. NKp30 is selectively expressed both in resting and activated human NK cells. In addition, NKp30 is also involved in NK-mediated induction of dendritic cell (DC) maturation. It has been demonstrated that NK cell activation signaling specifically induces lytic activity against several tumor cell types and synthesis of new NF-κB dependent proteins during the initiation of cytotoxicity.
Buffer
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
NCBI Official Name
natural cytotoxicity triggering receptor 3
NCBI Organism
Homo sapiens
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.05 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen