Vergleich

Activin Receptor IB Recombinant Protein

ArtNr PRS-92-607-0.05mg
Hersteller ProSci
Menge 0.05 mg
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against other
Konjugat/Tag Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Sequence LLCACTSCLQTNYTCETDGACMVSIFNLDGVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPSMWGPVEVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
NCBI Acvr1b
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Activin Receptor Type-1B, Activin Receptor Type IB, ACTR-IB, Activin Receptor-Like Kinase 4, ALK-4, Serine/Threonine-Protein Kinase Receptor R2, SKR2, ACVR1B, ACVRLK4, ALK4, Activin RIB
Lieferbar
Manufacturer - Applications
This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag
C-Fc tag
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Molecular Weight
37.7 kD
Background
Activin Receptor Type-1B (ACVR1B) is a single-pass type I membrane protein that belongs to the protein kinase superfamily. ACVR1B contains one GS domain and one protein kinase domain and is expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver. ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B, ACVR2A or ACVR2B activating ACVR1B through phosphorylation of its regulatory GS domain. They go on to recruit the R-SMADs, SMAD2 and SMAD3. ACVR1B also transducers signals of nodal, GDF-1, and Vg1. Mutations in ACVR1B are associated with pituitary tumors.
Buffer
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
NCBI Official Name
activin A receptor, type 1B
NCBI Organism
Mus musculus
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.05 mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 04.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen