« Zurück
Startseite /
Recombinant SARS-CoV Spike S1+S2 ECD(S-ECD) Protein

Recombinant SARS-CoV Spike S1+S2 ECD(S-ECD) Protein

ArtNr	RP01298LQ-100ug
Hersteller	Abclonal
Menge	100 ug
Kategorie	Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	Coronavirus
Host	SARS-CoV-Infected Cells
Konjugat/Tag	HIS
Purity	> 95% by SDS-PAGE.
Dry ice	Yes
Sequence	SDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDE
NCBI	SARS-CoV Spike S1+S2 ECD(S-ECD)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Spike,Spike RBD,Spike S1
Versandbedingung	Trockeneis
Lieferbar
Specificity	SARS-CoV
Manufacturer - Category	Coronavirus antigens
Shipping Temperature	dry ice
Storage Conditions	This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Description	Recombinant SARS-CoV S1+S2 ECD（S-ECD） Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser14-Pro1195) of sars-cov S1+S2 ECD（S-ECD） (Accession #NP_828851.1) fused with a 6xHis tag at the C-terminus.
Immunogen	Ser14-Pro1195
Route	C-His
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Coronavirus antigens
Protein Formulation	Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01298LQ-100ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern