Anti-HSPA1L Antibody

ArtNr	101-10754
Hersteller	Raybiotech
Menge	100 ug
Kategorie	Antibodies Immunohistochemistry Western Blot ELISA Primary Antibodies Immunostaining Proximity Ligation Analysis
Typ	Antibody Monoclonal
Applikationen	WB, IHC, ELISA
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEV D
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	HSPA1L
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	Proximity Ligation Analysis, ELISA, Western Blotting, IHC
Manufacturer - Category	Antibodies\|Primary Antibodies
Shipping Temperature	Blue ice
Storage Conditions	-20°C
Description	Human HSPA1L monoclonal antibody (100 ug)
Gene Symbols	HSPA1L
UNSPSC Code	12352203
Protein Name & Synonyms	HSPA1L
Format	In 1x PBS, pH 7.2
Manufacturer - Specificity	Human
Buffers	1x PBS, pH 7.2
Expiration	12 months from the date of shipment when stored properly.
Clonality	Monoclonal

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

101-10754.pdf

101-10754-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 06.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern