« Zurück
Home /
Anti-PYY-P1 Antibody, Biotinylated

Anti-PYY-P1 Antibody, Biotinylated

ArtNr	130-10473B-50
Hersteller	Raybiotech
Menge	50 ug
Kategorie	Antibodies Primary Antibodies
Typ	Antibody
Applikationen	ELISA
Specific against	other
Host	Hamster - Armenian
Isotype	IgG
Konjugat/Tag	Biotin
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Applications	ELISA (recommended work dilution= 1:128, 000)
Manufacturer - Category	Antibodies\|Primary Antibodies
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
Expiration	12 months from the date of shipment when stored properly.
Gene Symbols	PYY
Protein Name & Synonyms	Peptide YY (PYY) (PYY-I) (Peptide tyrosine tyrosine) [Cleaved into: Peptide YY(3-36) (PYY-II)]
UNSPSC Code	12352203
Reconstitution	A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial.
Clonality	Polyclonal
Preparation	This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen(PYY-P1: 29~64aa:NH2-YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYC). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified by Protein A affinity chromatography.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

130-10473B-50.pdf

130-10473B-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 24.07.2025

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern