« Zurück
Home /
High-Mobility Group Box 1, Human Recombinant

High-Mobility Group Box 1, Human Recombinant

Hersteller	Raybiotech
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Menge	1 mg
ArtNr	228-10767-3
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Storage/Stability	Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation	The HMG1 (1 mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4.
Expressed Region	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH.
Protein Name & Synonyms	HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1.
Expression System	E.Coli

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.