« Zurück
Startseite /
Macrophage Migration Inhibitory Factor, Human Recombinant (Active)

Macrophage Migration Inhibitory Factor, Human Recombinant (Active)

ArtNr	228-11106-3
Hersteller	Raybiotech
Menge	1 mg
Quantity options	3 x 10 ug 1 mg
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Colorectal Cancer Breast Cancer
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	MIF, Active
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Proteins\|Recombinant Proteins\|Human Proteins\|Enzymes & Inhibitors
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
UNSPSC Code	12352202
Formulation	MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Expressed Region	MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA.
Protein Name & Synonyms	Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
Reconstitution	It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml.
Biological activity	Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

228-11106-3.pdf

228-11106-3-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern