IP-10 (CXCL10)

ArtNr	RLT-100-057
Hersteller	ReliaTech
Menge	25ug
Kategorie	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Typ	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Monkey (Cynomolgus, Simian)
Host	E.coli
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	CXCL10
Lieferbar
NCBI Gene ID	3627
Uniprot	P02778
Biological Activity	Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml.
Description	IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines.
Endotoxin Levels	< 0.1 ng/µg of protein (<1EU/µg)
Length [aa]	77
Molecular Weight	8.6 kDa
mRNA RefSeq	NM_001565.3
Protein RefSeq	NP_001556.2
Protein Sequence	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Purity Confirmation	> 98% by SDS-PAGE & HPLC analyses
Synonyms	CXCL10
Uniprot ID	P02778

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25ug

lieferbar

Lieferung vsl. bis 21.08.2025

Express-Lieferung: 20 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern